PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 331aa    MW: 35861.7 Da    PI: 9.0631
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685293PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-28800PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-3957115361
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk +
  Lsa005777  57 NQKLRCPRCDSANTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKGT 115
                6899****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-3258113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.36660114IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2560113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MIQELFGGGA TGLLNRDRDL PVSGAFEPSP SPSPSSSTTN TATTNAPTAA NPTTSDNQKL  60
RCPRCDSANT KFCYYNNYNL TQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKGTTIATT  120
IGKPISSNGK LKAVVSSELG KSGFINGFEH EFTHNPILWS APPQTSHLLS LLRATQNPNP  180
NFASNSVTHI KDQGFMVGSH MSNLGFEPLG QASSLGLCSS LWRNNQVNQQ AQQNHHEQHQ  240
QGMMNSGHEV QNTENNQGQR YQRLRSSSPV NYFHHDQTTP LILGSNVANT SSSISTSTIL  300
DSSPVLASGE LGFWNQSLPW SDLAAANGAY P
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003635142.19e-91PREDICTED: dof zinc finger protein DOF1.1-like
TrEMBLA0A124SC390.0A0A124SC39_CYNCS; Zinc finger, Dof-type
STRINGVIT_00s0253g00060.t013e-89(Vitis vinifera)